PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 306aa    MW: 35129.6 Da    PI: 9.7522
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618980.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM67.34.3e-2151265128
             NAM   5 frFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                     ++F+ +d +l+++ L k ++gk l++e  i  vdiy+ ePw+L   +++ +k  yf s+ +kk++t+ r +r+t +g W ++ k k++l++ ++ 
  XP_009618980.1   5 VQFRLSDTNLIMQ-LLKFLAGKCLPTEGLIGFVDIYSKEPWQLIGDISS-KKTHYFLSQLKKKKPTDARFKRTTGNGSWTQQNKGKKILDEdGSL 97 
                     78999******77.567888999999899**************866644.57789999********************************94555 PP

             NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                      +g k++L +   ++ ++ + +W+m ey l
  XP_009618980.1  98 IIGYKRSLSYK-HKKDSSLNGRWLMMEYFL 126
                     69*******98.5666669*********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.4841150IPR003441NAC domain
PfamPF023658.5E-94125IPR003441NAC domain
SuperFamilySSF1019412.09E-216149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEKNVQFRLS DTNLIMQLLK FLAGKCLPTE GLIGFVDIYS KEPWQLIGDI SSKKTHYFLS  60
QLKKKKPTDA RFKRTTGNGS WTQQNKGKKI LDEDGSLIIG YKRSLSYKHK KDSSLNGRWL  120
MMEYFLADSL LQELKSNEAK EFVICAIKKN PRSEIRENTD ATIVEYKRFI DRVLQEGVHL  180
QTSEPSQQSI MILSKNSPMM SESTSSDVLS MGQLEQNNGM LVQTDSDEFF GILNVQNQEC  240
YYQEARNRKT TASAISLELE LMVSYLMVVF KISSSLTKHC LHLMVLRKME KFAASLTSKR  300
LRQFLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7532650.0EU753265.1 Nicotiana tabacum NAC transcription factor (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618980.10.0PREDICTED: uncharacterized protein LOC104111082 isoform X1
TrEMBLB3VK761e-139B3VK76_TOBAC; NAC transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9815725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.12e-14NAC domain containing protein 96